{"product_id":"proteintech-66403-1-ig","title":"Proteintech, 66403-1-Ig, PSMB10 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMB10 (66403-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMB10 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n66403-1-Ig targets PSMB10 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, Ramos cells,  U-937 cells,  rat thymus tissue,  human spleen tissue,  pig thymus tissue\nPositive IHC detected in: human liver cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMB10(Proteasome subunit beta type-10) is also named as LMP10, MECL1.It belongs to the peptidase T1B family and is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8835 Product name: Recombinant human PSMB10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-273 aa of BC017198 Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE Predict reactive species\nFull Name: proteasome (prosome, macropain) subunit, beta type, 10\nCalculated Molecular Weight: 273 aa, 29 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC017198\nGene Symbol: PSMB10\nGene ID (NCBI): 5699\nRRID: AB_2881777\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P40306\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888314863785,"sku":"66403-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66403-1-ig","provider":"Iright","version":"1.0","type":"link"}