{"product_id":"proteintech-66417-1-ig","title":"Proteintech, 66417-1-Ig, LAP3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LAP3 (66417-1-Ig) by Proteintech is a Monoclonal antibody targeting LAP3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human,  mouse,  rat,  pig samples\n66417-1-Ig targets LAP3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human,  mouse,  rat,  pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells,  C2C12 cell,  HeLa cells,  HepG2 cells\nPositive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLAP3(Leucine aminopeptidase 3) is also named as LAPEP, PEPS(peptidase S) and belongs to the peptidase M17 family. It can catalyzes the removal of unsubstituted N-terminal amino-acids from various peptides and be presumably involved in the processing end regular turnover of intracellular proteins. PEPS is found in a wide variety of tissues and cultured cells but not in red cells and skin. The enzyme can utilize several di-, tri-, and tetrapeptides as substrates and is the slowest migrating of the peptidases after electrophoresis.(PMID:689684). LAP3 has two isoform with MW of 52 and 56 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6300 Product name: Recombinant human LAP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 271-519 aa of BC065564 Sequence: NANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA Predict reactive species\nFull Name: leucine aminopeptidase 3\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC065564\nGene Symbol: LAP3\nGene ID (NCBI): 51056\nRRID: AB_2881789\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P28838\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888289599657,"sku":"66417-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66417-1-ig","provider":"Iright","version":"1.0","type":"link"}