{"product_id":"proteintech-66434-1-ig","title":"Proteintech, 66434-1-Ig, GDI1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GDI1 (66434-1-Ig) by Proteintech is a Monoclonal antibody targeting GDI1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n66434-1-Ig targets GDI1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Saos-2 cells, HEK-293 cells,  mouse brain tissue,  Neuro-2a cells,  pig brain tissue,  rat brain tissue,  U-251 cells,  rabbit brain tissue,  PANC-1 cells,  MCF-7 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family. GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI1 is expressed primarily in neural and sensory tissues and also in secretory cells, displaying a diffuse, cytoplasmic distribution in cells. It runs as a 55 kDa protein in SDS-PAGE. (PMID: 7929030,PMID: 19570034)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17511 Product name: Recombinant human GDI1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-209 aa of BC000317 Sequence: MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRI Predict reactive species\nFull Name: GDP dissociation inhibitor 1\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC000317\nGene Symbol: GDI1\nGene ID (NCBI): 2664\nRRID: AB_2881804\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P31150\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888020213929,"sku":"66434-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66434-1-ig","provider":"Iright","version":"1.0","type":"link"}