{"product_id":"proteintech-66445-1-ig","title":"Proteintech, 66445-1-Ig, Gamma Catenin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Gamma Catenin (66445-1-Ig) by Proteintech is a Monoclonal antibody targeting Gamma Catenin in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig, canine samples\n66445-1-Ig targets Gamma Catenin in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue, A431 cells,  HT-29 cells,  MDCK cells,  rat heart tissue,  T-47D cells\nPositive IHC detected in: human breast cancer tissue, human skin tissue,  human stomach cancer tissue,  mouse stomach tissue,  rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPlakoglobin (γ-catenin), a member of the Armadillo proteins, plays important roles in cell adhesion with α-catenin and β-catenin, is involved in Wnt signaling, and is translocated into the nucleus and binds LEF1. Plakoglobin is a major cytoplasmic component of both desmosomes and adherens junctions, and is the only known constituent common to submembranous plaques in both of these structures, which are located at the intercalated disc (ICD) of cardiomyocytes. Plakoglobin links cadherins to the actin cytoskeleton. Mutations in plakoglobin are associated with arrhythmogenic right ventricular dysplasia and Pemphigus vulgaris.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, canine\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1627 Product name: Recombinant human JUP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 396-745 aa of BC011865 Sequence: LVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDLDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA Predict reactive species\nFull Name: junction plakoglobin\nCalculated Molecular Weight: 82 kDa\nObserved Molecular Weight: 82 kDa\nGenBank Accession Number: BC011865\nGene Symbol: Gamma Catenin\nGene ID (NCBI): 3728\nRRID: AB_2881814\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P14923\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888028602537,"sku":"66445-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66445-1-ig","provider":"Iright","version":"1.0","type":"link"}