{"product_id":"proteintech-66452-1-ig","title":"Proteintech, 66452-1-Ig, ZO-1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZO-1 (66452-1-Ig) by Proteintech is a Monoclonal antibody targeting ZO-1 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, canine samples\n66452-1-Ig targets ZO-1 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, HeLa cells,  COLO 320 cells,  A431 cells,  LNCaP cells,  HEK-293 cells,  HepG2 cells\nPositive IHC detected in: human pancreas cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human breast cancer tissue\nPositive IF\/ICC detected in: MCF-7 cells, MDCK cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTight junction (or zonula occludens) form the continuous intercellular barrier between epithelial and endothelial cells, which is required to separate tissue spaces and regulate selective movement of solutes across the epithelium and endothelium (PMID: 20066090). ZO-1 (also known as TJP1) is a peripheral membrane phosphoprotein located on the cytoplasmic face and is expressed in tight junctions of both epithelial and endothelial cells (PMID: 3528172). It binds the transmembrane proteins occludin and the claudins linking them to cytoskeletal actin (PMID: 17418867). ZO-1 belongs to a family of multidomain proteins known as the membrane-associated guanylate kinase homologs (MAGUKs). It is a pivotal tight junction protein and may be involved in signalling mechanisms regulating cell proliferation and differentiation (PMID: 22782886).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, canine\nCited Reactivity: human, pig, canine\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16454 Product name: Recombinant human ZO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1446-1748 aa of BC111712 Sequence: SLHIHSKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDTAQAAFYPQKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHKPDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF Predict reactive species\nFull Name: tight junction protein 1 (zona occludens 1)\nCalculated Molecular Weight: 1748 aa, 195 kDa\nObserved Molecular Weight: 230 kDa\nGenBank Accession Number: BC111712\nGene Symbol: ZO-1\nGene ID (NCBI): 7082\nRRID: AB_2881821\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q07157\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887974699177,"sku":"66452-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66452-1-ig","provider":"Iright","version":"1.0","type":"link"}