{"product_id":"proteintech-66455-1-ig","title":"Proteintech, 66455-1-Ig, EGFR Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EGFR (66455-1-Ig) by Proteintech is a Monoclonal antibody targeting EGFR in WB, IHC, ELISA applications with reactivity to human samples\n66455-1-Ig targets EGFR in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, EC109 cells,  A549 cells,  HeLa cells,  HepG2 cells,  LNCaP cells,  PC-3 cells,  SKOV-3 cells,  MDA-MB-468 cells,  MDA-MB-231 cells,  PC-3 clles\nPositive IHC detected in: human tonsillitis tissue, human breast cancer tissue,  human cervical cancer tissue,  human colon cancer tissue,  human gliomas tissue,  human lung cancer tissue,  human placenta tissue,  human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEGFR, also named as ERBB1, is a cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. The gene resides on chromosome 7p12, encoding a 170 kDa membrane-associated glycoprotein. Recent studies have shown EGFR plays a critical role in cancer development and progression, including cell proliferation, apoptosis, angiogenesis, and metastatic spread. Mutations in this gene are associated with lung cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24947 Product name: Recombinant human EGFR protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 291-534 aa of BC094761 Sequence: VCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNC Predict reactive species\nFull Name: epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)\nCalculated Molecular Weight: 1210 aa, 134 kDa\nObserved Molecular Weight: 145-180 kDa\nGenBank Accession Number: BC094761\nGene Symbol: EGFR\nGene ID (NCBI): 1956\nRRID: AB_2881824\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P00533\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887974011049,"sku":"66455-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66455-1-ig","provider":"Iright","version":"1.0","type":"link"}