{"product_id":"proteintech-66459-1-ig","title":"Proteintech, 66459-1-Ig, STAT5A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe STAT5A (66459-1-Ig) by Proteintech is a Monoclonal antibody targeting STAT5A in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n66459-1-Ig targets STAT5A in WB, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, U-937 cells,  rat spleen tissue,  pig spleen tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTAT5A, also named as STAT5, belongs to the transcription factor STAT family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT5A is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different GHs. Activation of STAT5A in myeloma and lymphoma associated with a TEL\/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for the tumorigenesis. The mouse counterpart of human STAT5A is found to induce the expression of BCL2L1\/BCL-X(L), which suggests the antiapoptotic function of STAT5A in cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19546 Product name: Recombinant human STAT5A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 445-794 aa of BC027036 Sequence: ESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS Predict reactive species\nFull Name: signal transducer and activator of transcription 5A\nCalculated Molecular Weight: 794 aa, 92 kDa\nObserved Molecular Weight: 95 kDa\nGenBank Accession Number: BC027036\nGene Symbol: STAT5A\nGene ID (NCBI): 6776\nRRID: AB_2881828\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P42229\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888050360489,"sku":"66459-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66459-1-ig","provider":"Iright","version":"1.0","type":"link"}