{"product_id":"proteintech-66466-1-ig","title":"Proteintech, 66466-1-Ig, JAK1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe JAK1 (66466-1-Ig) by Proteintech is a Monoclonal antibody targeting JAK1 in WB, IHC, ELISA applications with reactivity to human, rat, mouse samples\n66466-1-Ig targets JAK1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, Jurkat cells,  rat spleen tissue,  PC-12 cells,  NIH\/3T3 cells,  RAW 264.7 cells,  Ramos cells,  Daudi cells\nPositive IHC detected in: human breast cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nJanus kinase 1(JAK1), is a member of a class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. JAK1 is essential for signaling for certain type I and type II cytokines. JAK1 plays a critical role in initiating responses to multiple major cytokine receptor families. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17940 Product name: Recombinant human JAK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8-363 aa of BC132729 Sequence: EDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEELCIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIREEW Predict reactive species\nFull Name: Janus kinase 1 (a protein tyrosine kinase)\nCalculated Molecular Weight: 1154 aa, 133 kDa\nObserved Molecular Weight: 133 kDa\nGenBank Accession Number: BC132729\nGene Symbol: JAK1\nGene ID (NCBI): 3716\nRRID: AB_2881834\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P23458\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887975518377,"sku":"66466-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66466-1-ig","provider":"Iright","version":"1.0","type":"link"}