{"product_id":"proteintech-66471-1-ig","title":"Proteintech, 66471-1-Ig, TFF2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TFF2 (66471-1-Ig) by Proteintech is a Monoclonal antibody targeting TFF2 in WB, ELISA applications with reactivity to human, pig, rat samples\n66471-1-Ig targets TFF2 in WB, ELISA applications and shows reactivity with human, pig, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat pancreas tissue, pig pancreas tissue,  pig stomach tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa),  secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18765 Product name: Recombinant human TFF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-129 aa of BC032820 Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY Predict reactive species\nFull Name: trefoil factor 2\nCalculated Molecular Weight: 129 aa, 14 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC032820\nGene Symbol: TFF2\nGene ID (NCBI): 7032\nRRID: AB_2881837\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q03403\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888330428585,"sku":"66471-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66471-1-ig","provider":"Iright","version":"1.0","type":"link"}