{"product_id":"proteintech-66481-1-ig","title":"Proteintech, 66481-1-Ig, B7-H3\/CD276 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe B7-H3\/CD276 (66481-1-Ig) by Proteintech is a Monoclonal antibody targeting B7-H3\/CD276 in WB, IHC, IF-P, ELISA applications with reactivity to human, pig samples\n66481-1-Ig targets B7-H3\/CD276 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A431 cells,  PC-3 cells\nPositive IHC detected in: human tonsillitis tissue, human placenta tissue,  human prostate cancer tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:2500-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nB7-H3 (CD276) is a type I transmembrane protein expressed on many tissues and cell types. B7-H3 is a 100-kDa glycoprotein that belongs to the B7 immunoregulatory family and participates in the regulation of T-cell-mediated immune response probably by functioning as both a T cell costimulator and coinhibitor (PMID: 25567370; 20696859). Overexpressed on a wide range of human solid cancers, B7-H3 has been implicated in cancer progression and metastasis and becomes an attractive target for cancer immunotherapy (PMID: 27208063).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6006 Product name: Recombinant human CD276 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 41-181 aa of BC062581 Sequence: LVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDG Predict reactive species\nFull Name: CD276 molecule\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC062581\nGene Symbol: CD276\nGene ID (NCBI): 80381\nRRID: AB_2881847\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q5ZPR3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887992688809,"sku":"66481-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66481-1-ig","provider":"Iright","version":"1.0","type":"link"}