{"product_id":"proteintech-66524-1-ig","title":"Proteintech, 66524-1-Ig, CGGBP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CGGBP1 (66524-1-Ig) by Proteintech is a Monoclonal antibody targeting CGGBP1 in WB, ELISA applications with reactivity to Human, Rat, mouse samples\n66524-1-Ig targets CGGBP1 in WB, ELISA applications and shows reactivity with Human, Rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, NIH\/3T3 cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCGGBP1, also named as CGGBP, is a 20 kDa CGG-binding protein. It binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. CGGBP1 may play a role in regulating FMR1 promoter. It is a bona fide midbody protein required for normal abscission and mitosis in general.(PMID:20832400)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rat, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1129 Product name: Recombinant human CGGBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC005222 Sequence: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRTYLPDGYENENQLLNSQDC Predict reactive species\nFull Name: CGG triplet repeat binding protein 1\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC005222\nGene Symbol: CGGBP1\nGene ID (NCBI): 8545\nRRID: AB_2881887\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9UFW8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888108032169,"sku":"66524-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66524-1-ig","provider":"Iright","version":"1.0","type":"link"}