{"product_id":"proteintech-66542-1-ig","title":"Proteintech, 66542-1-Ig, Septin 7 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Septin 7 (66542-1-Ig) by Proteintech is a Monoclonal antibody targeting Septin 7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n66542-1-Ig targets Septin 7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HEK-293 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 tissue\nPositive IHC detected in: human gliomas tissue, human lung tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSeptins (SEPTs) are members of a conserved family of cytoskeletal GTPases involved in various cellular processes, including cytoskeleton organization, cytokinesis, and membrane dynamics. Septin 7 is a unique septin required for filament formation. It has also been reported to be involved in migration and invasion in various cancer cells, including breast cancer and glioma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4309 Product name: Recombinant human SEPT7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 110-417 aa of BC025987 Sequence: VIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF Predict reactive species\nFull Name: septin 7\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 48-51 kDa\nGenBank Accession Number: BC025987\nGene Symbol: Septin 7\nGene ID (NCBI): 989\nRRID: AB_2881904\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q16181\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888049442985,"sku":"66542-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66542-1-ig","provider":"Iright","version":"1.0","type":"link"}