{"product_id":"proteintech-66543-1-ig","title":"Proteintech, 66543-1-Ig, SIRT4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SIRT4 (66543-1-Ig) by Proteintech is a Monoclonal antibody targeting SIRT4 in WB, ELISA applications with reactivity to human samples\n66543-1-Ig targets SIRT4 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NCCIT cell,  PC-3 cells,  L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:80000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSIRT4, also named as NAD-dependent protein lipoamidase sirtuin-4, mitochondria, is a 314 amino acid protein, which belongs to the sirtuin family. Class II subfamily. SIRT4 is detected in vascular smooth muscle and striated muscle. SIRT4 is detected in insulin-producing beta-cells in pancreas islets of Langerhans. SIRT4 Acts as NAD-dependent protein lipoamidase, ADP-ribosyl transferase and deacetylase. It catalyzes more efficiently removal of lipoyl- and biotinyl- than acetyl-lysine modifications and inhibits the pyruvate dehydrogenase complex (PDH) activity via the enzymatic hydrolysis of the lipoamide cofactor from the E2 component, DLAT, in a phosphorylation-independent manner. SIRT4 expression is down-regulated in a number of cancers, while overexpression reduces cell proliferation, transformation, and tumor development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17347 Product name: Recombinant human SIRT4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-314 aa of BC109319 Sequence: MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC Predict reactive species\nFull Name: sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)\nCalculated Molecular Weight: 314 aa, 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC109319\nGene Symbol: SIRT4\nGene ID (NCBI): 23409\nRRID: AB_2881905\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9Y6E7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887985053865,"sku":"66543-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66543-1-ig","provider":"Iright","version":"1.0","type":"link"}