{"product_id":"proteintech-66557-1-ig","title":"Proteintech, 66557-1-Ig, HE4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HE4 (66557-1-Ig) by Proteintech is a Monoclonal antibody targeting HE4 in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66557-1-Ig targets HE4 in IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SKOV-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:1000-1:5000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWFDC2, also named as HE4, is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. HE4 is expressed in a number of normal tissues, and it is also highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. In some study, HE4 was referred to as a biomarker for ovarian carcinoma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5936 Product name: Recombinant human HE4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-124 aa of BC046106 Sequence: GFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF Predict reactive species\nFull Name: WAP four-disulfide core domain 2\nCalculated Molecular Weight: 13 kDa\nGenBank Accession Number: BC046106\nGene Symbol: HE4\nGene ID (NCBI): 10406\nRRID: AB_2881918\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q14508\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888282620073,"sku":"66557-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66557-1-ig","provider":"Iright","version":"1.0","type":"link"}