{"product_id":"proteintech-66564-1-ig","title":"Proteintech, 66564-1-Ig, TBR1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TBR1 (66564-1-Ig) by Proteintech is a Monoclonal antibody targeting TBR1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n66564-1-Ig targets TBR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, pig cerebellum tissue,  rat cerebellum tissue,  rat brain tissue,  mouse brain tissue,  rabbit brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTBR1, also named T-box brain protein 1, is a 682 amino acid protein, which contains one T-box DNA-binding domain and localizes in the nucleus. TBR1 is expressed in the brain and as a transcriptional regulator is involved in developmental processes. TBR1 is required for normal brain development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15262 Product name: Recombinant human TBR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-196 aa of BC104844 Sequence: MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYGHSYQGAPFYQFSSTQ Predict reactive species\nFull Name: T-box, brain, 1\nCalculated Molecular Weight: 682 aa, 74 kDa\nObserved Molecular Weight: 74 kDa\nGenBank Accession Number: BC104844\nGene Symbol: TBR1\nGene ID (NCBI): 10716\nRRID: AB_2881925\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q16650\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887997145257,"sku":"66564-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66564-1-ig","provider":"Iright","version":"1.0","type":"link"}