{"product_id":"proteintech-66591-1-ig","title":"Proteintech, 66591-1-Ig, FASN Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FASN (66591-1-Ig) by Proteintech is a Monoclonal antibody targeting FASN in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66591-1-Ig targets FASN in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  HeLa cells,  Jurkat cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0975 Product name: Recombinant human FASN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 142-439 aa of BC007909 Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG Predict reactive species\nFull Name: fatty acid synthase\nCalculated Molecular Weight: 272 kDa\nObserved Molecular Weight: 272 kDa\nGenBank Accession Number: BC007909\nGene Symbol: FASN\nGene ID (NCBI): 2194\nRRID: AB_2881951\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P49327\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887985643689,"sku":"66591-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66591-1-ig","provider":"Iright","version":"1.0","type":"link"}