{"product_id":"proteintech-66650-1-ig","title":"Proteintech, 66650-1-Ig, RASGRP3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RASGRP3 (66650-1-Ig) by Proteintech is a Monoclonal antibody targeting RASGRP3 in WB, IF\/ICC, ELISA applications with reactivity to Human, mouse samples\n66650-1-Ig targets RASGRP3 in WB, IF\/ICC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, HEK-293 cells,  Jurkat cells,  Ramos cells,  Raw 264.7 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAS guanyl releasing protein 3 (RasGRP3) is a member of the RasGRP family and is able to promote guanine nucleotide exchange of Ha-Ras, R-Ras and Rap1 (PMID: 9582122). RasGRP3 is involved in a diverse range of important biological processes. RasGRP3 has emerged as an important mediator of signaling downstream from receptor coupled phosphoinositide turnover in B and T cells. Overexpression of RasGRP3 is commonly associated with many malignancies, such as pre-Bcell leukemia, Burkitt’s lymphoma and natural killer-like T-cell leukemia. Recently, it has been reported that upregulation of RASGRP3 expression in prostate cancer correlates with aggressive capabilities and predicts biochemical recurrence after radical prostatectomy (PMID: 24418912).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3810 Product name: Recombinant human RASGRP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 342-690 aa of BC027849 Sequence: SLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG Predict reactive species\nFull Name: RAS guanyl releasing protein 3 (calcium and DAG-regulated)\nCalculated Molecular Weight: 690 aa, 78 kDa\nObserved Molecular Weight: 78 kDa\nGenBank Accession Number: BC027849\nGene Symbol: RASGRP3\nGene ID (NCBI): 25780\nRRID: AB_2882007\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8IV61\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888317714601,"sku":"66650-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66650-1-ig","provider":"Iright","version":"1.0","type":"link"}