{"product_id":"proteintech-66654-1-ig","title":"Proteintech, 66654-1-Ig, RAB43 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB43 (66654-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB43 in WB, ELISA applications with reactivity to human samples\n66654-1-Ig targets RAB43 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HEK-293 cells,  human brain tissue,  Jurkat cells,  HepG2 cells,  L02 cells,  human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRas-related GTP-binding protein 43 (RAB43) is a member of the Ras superfamily.  RAB43 is mainly located in endoplasmic reticulum and Golgi, and plays a role as a key regulator of vesicle movement, signal transduction and tethering membrane events in membrane trafficking.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26911 Product name: Recombinant human RAB43 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 91-212 aa of BC062319 Sequence: ANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC Predict reactive species\nFull Name: RAB43, member RAS oncogene family\nCalculated Molecular Weight: 212 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC062319\nGene Symbol: RAB43\nGene ID (NCBI): 339122\nRRID: AB_2882011\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q86YS6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888072872105,"sku":"66654-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66654-1-ig","provider":"Iright","version":"1.0","type":"link"}