{"product_id":"proteintech-66681-1-ig","title":"Proteintech, 66681-1-Ig, ERC1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERC1 (66681-1-Ig) by Proteintech is a Monoclonal antibody targeting ERC1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples\n66681-1-Ig targets ERC1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  HSC-T6,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nERC is an acronym based on previous separate namings of members of this protein family, ELKS, Rab6IP2 and CAST (PMID: 12391317). They are known to bind RIMs, the active zone proteins that regulate neurotransmitter release. ERC1 (ELKS) is an essential regulatory subunit of the IKK complex and likely functions by recruiting IκBα to the complex (PMID: 15218148). Multiple isoforms of ERC1 mRNA are generated by alternative splicing (PMID: 12203787). There are two known splice variants of ERC1 protein that differ at their C termini, ERC1a and ERC1b. ERC1a is ubiquitously expressed, whereas ERC1b is brain-specific (PMID: 12391317; 12923177).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: canine\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17665 Product name: Recombinant human ERC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 985-1116 aa of BC132782 Sequence: DNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPDILEQVVNALEESS Predict reactive species\nFull Name: ELKS\/RAB6-interacting\/CAST family member 1\nCalculated Molecular Weight: 1116 aa, 128 kDa\nObserved Molecular Weight: 135 kDa\nGenBank Accession Number: BC132782\nGene Symbol: ERC1\nGene ID (NCBI): 23085\nRRID: AB_2882035\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8IUD2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888061763753,"sku":"66681-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66681-1-ig","provider":"Iright","version":"1.0","type":"link"}