{"product_id":"proteintech-66683-1-ig","title":"Proteintech, 66683-1-Ig, Betacellulin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Betacellulin (66683-1-Ig) by Proteintech is a Monoclonal antibody targeting Betacellulin in WB, ELISA applications with reactivity to human samples\n66683-1-Ig targets Betacellulin in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, NCCIT cells,  A549 cells,  MDA-MB-231 cells,  T-47D cells,  PC-3 cells,  BxPC-3 cells,  DU 145 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBetacellulin (BTC), a member of the epidermal growth factor (EGF) family, binds and activates ErbB1 and ErbB4 homodimers. BTC is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. BTC was expressed in tumors and involved in tumor growth progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26724 Product name: Recombinant human BTC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-118 aa of BC011618 Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ Predict reactive species\nFull Name: betacellulin\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC011618\nGene Symbol: BTC\nGene ID (NCBI): 685\nRRID: AB_2882037\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P35070\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888037449897,"sku":"66683-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66683-1-ig","provider":"Iright","version":"1.0","type":"link"}