{"product_id":"proteintech-66693-1-ig","title":"Proteintech, 66693-1-Ig, CALD1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CALD1 (66693-1-Ig) by Proteintech is a Monoclonal antibody targeting CALD1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n66693-1-Ig targets CALD1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCI-H1299 cells, HeLa cells,  U2OS cells,  HepG2 cells,  PC-3 cells,  SKOV-3 cells,  A2780 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells,  Calu-1 cells,  Caco-2 cells,  Caki-1 cells,  MCF-10A cells,  LNCaP cells,  SK-N-SH cells\nPositive IHC detected in: human colon cancer tissue, human colon tissue,  human hysteromyoma tissue,  mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag13676 Product name: Recombinant human CALD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 196-538 aa of BC040354 Sequence: EKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV Predict reactive species\nFull Name: caldesmon 1\nCalculated Molecular Weight: 538 aa, 63 kDa\nObserved Molecular Weight: 70 kDa~75 kDa\nGenBank Accession Number: BC040354\nGene Symbol: CALD1\nGene ID (NCBI): 800\nRRID: AB_2882047\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q05682\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888018673833,"sku":"66693-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66693-1-ig","provider":"Iright","version":"1.0","type":"link"}