{"product_id":"proteintech-66698-1-ig","title":"Proteintech, 66698-1-Ig, OCIAD1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe OCIAD1 (66698-1-Ig) by Proteintech is a Monoclonal antibody targeting OCIAD1 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n66698-1-Ig targets OCIAD1 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, rat testis tissue,  mouse testis tissue\nPositive IHC detected in: human liver cancer tissue, human kidney tissue,  human pancreas cancer tissue,  human thyroid cancer tissue,  mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue, HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOCIAD1 was first identified by immunoscreening of an ovarian carcinoma cDNA expression library with ascites fluid from ovarian cancer patients (PMID: 11162530). OCIAD1 has been reported as a key player in ovarian cancer cell adhesion, as well as a key player in generating ovarian cancer recurrence (PMID: 18328549; 20515946). In addition to its roles in cancer, OCIAD1 participates in maintaining stem cell potency by regulating the Jak\/STAT pathway (PMID: 23972987). Several alternatively spliced forms of OCIAD1 gene have been identified. The longest form (1.4 kb) is predicted to encode for a 27.6 kDa protein of 245 amino acids. This antibody detects OCIAD1 with an apparent molecular weight of ~35 kDa as has been demonstrated by several researches (PMID: 27345969; 27345976).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9977 Product name: Recombinant human OCIAD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-245 aa of BC003409 Sequence: MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE Predict reactive species\nFull Name: OCIA domain containing 1\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC003409\nGene Symbol: OCIAD1\nGene ID (NCBI): 54940\nRRID: AB_2882051\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NX40\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888069726377,"sku":"66698-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66698-1-ig","provider":"Iright","version":"1.0","type":"link"}