{"product_id":"proteintech-66715-1-ig","title":"Proteintech, 66715-1-Ig, GSTP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSTP1 (66715-1-Ig) by Proteintech is a Monoclonal antibody targeting GSTP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, rat samples\n66715-1-Ig targets GSTP1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuH-7 cells, HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  HCT 116 cells,  Caco-2 cells,  SCaBER cells,  MCF-10A cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human colon cancer tissue, human cervical cancer tissue,  human kidney tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8880 Product name: Recombinant human GSTP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-210 aa of BC010915 Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ Predict reactive species\nFull Name: glutathione S-transferase pi 1\nCalculated Molecular Weight: 210 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC010915\nGene Symbol: GSTP1\nGene ID (NCBI): 2950\nRRID: AB_2882066\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P09211\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888000749737,"sku":"66715-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66715-1-ig","provider":"Iright","version":"1.0","type":"link"}