{"product_id":"proteintech-66727-1-ig","title":"Proteintech, 66727-1-Ig, Cytokeratin 5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytokeratin 5 (66727-1-Ig) by Proteintech is a Monoclonal antibody targeting Cytokeratin 5 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, pig samples\n66727-1-Ig targets Cytokeratin 5 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HaCaT cells, SKOV-3 cells,  mouse skin tissue,  MCF-7 cells,  A549 cells,  A-253 cells,  A431 cells,  human saliva,  pig skin tissue\nPositive IHC detected in: human tonsillitis tissue, human breast cancer tissue,  human breast hyperplasia tissue,  human cervical cancer tissue,  human lung cancer tissue,  human oesophagus cancer tissue,  human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human oesophagus cancer tissue, human prostate cancer tissue,  human lung cancer tissue\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunohistochemistry (IHC): IHC : 1:5000-1:20000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKeratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins  with MW from 52 kDa (KRT8) to 67 kDa (KRT18).\nKeratin 5, one 58-kD type II keratin, is coexpressed with a 50-kD keratin 14 in stratified squamous epithelia. Keratin 5, one 58-kD type II keratin,  is coexpressed with a 50-kD tyK14 in stratified squamous epithelia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24184 Product name: Recombinant human KRT5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 316-491 aa of BC024292 Sequence: THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI Predict reactive species\nFull Name: keratin 5\nCalculated Molecular Weight: 590 aa, 62 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC024292\nGene Symbol: Cytokeratin 5\nGene ID (NCBI): 3852\nRRID: AB_2882077\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P13647\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887991673001,"sku":"66727-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66727-1-ig","provider":"Iright","version":"1.0","type":"link"}