{"product_id":"proteintech-66731-1-ig","title":"Proteintech, 66731-1-Ig, HIF2α\/EPAS1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HIF2α\/EPAS1 (66731-1-Ig) by Proteintech is a Monoclonal antibody targeting HIF2α\/EPAS1 in WB, IHC, ELISA applications with reactivity to Human samples\n66731-1-Ig targets HIF2α\/EPAS1 in WB, IHC, IF, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEndothelial PAS domain-containing protein 1 (EPAS1), also known as Hypoxia-inducible factor 2-alpha (HIF2-alpha,HIF2A), is a transcription factor involved in the induction of oxygen regulated genes. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. May also play a role in the formation of the endothelium that gives rise to the blood brain barrier. Potent activator of the Tie-2 tyrosine kinase expression. Activation seems to require recruitment of transcriptional coactivators such as CREBPB and probably EP300. Interaction with redox regulatory protein APEX seems to activate CTAD. EPAS1 is expressed in most tissues, with highest levels in placenta, lung and heart. Selectively expressed in endothelial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, bovine\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24886 Product name: Recombinant human EPAS1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 521-870 aa of BC051338 Sequence: FNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT Predict reactive species\nFull Name: endothelial PAS domain protein 1\nCalculated Molecular Weight: 96 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC051338\nGene Symbol: HIF2α\nGene ID (NCBI): 2034\nRRID: AB_2882081\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99814\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888000782505,"sku":"66731-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66731-1-ig","provider":"Iright","version":"1.0","type":"link"}