{"product_id":"proteintech-66741-1-ig","title":"Proteintech, 66741-1-Ig, CHOP\/GADD153 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHOP\/GADD153 (66741-1-Ig) by Proteintech is a Monoclonal antibody targeting CHOP\/GADD153 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n66741-1-Ig targets CHOP\/GADD153 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HSC-T6 cells, HepG2 cells,  C6 cells,  NIH\/3T3 cells,  Tunicamycin treated HepG2 cells\nPositive IHC detected in: human cervical cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHOP, also known as GADD153 or DDIT3, is a highly conserved gene in both the structural and regulatory regions. Imposed by unfolded and misfolded proteins, CHOP is significantly induced by ER stress. CHOP is considered a proapoptotic marker of ER stress dependent cell death. CHOP acts as a dominant-negative inhibitor of the transcription factor C\/EBP and LAP. It may play an important role in the malignant transformation of nevus to melanoma.  The calculated molecular weight of CHOP is 19 kDa, but the protein migrates on an SDS-PAGE gel with an observed molecular mass of 29 kDa (PMID: 1547942).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, rabbit, shrew\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7354 Product name: Recombinant human CHOP; GADD153 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC003637 Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA Predict reactive species\nFull Name: DNA-damage-inducible transcript 3\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC003637\nGene Symbol: CHOP\nGene ID (NCBI): 1649\nRRID: AB_2882089\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P35638\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887979778217,"sku":"66741-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66741-1-ig","provider":"Iright","version":"1.0","type":"link"}