{"product_id":"proteintech-66742-1-ig","title":"Proteintech, 66742-1-Ig, SRF Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SRF (66742-1-Ig) by Proteintech is a Monoclonal antibody targeting SRF in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n66742-1-Ig targets SRF in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, LNCaP cells,  MCF-7 cells,  RAW 264.7 cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  SK-BR-3 cells,  IMR-32 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSerum response factor (SRF) is a transcription factor that binds the serum response element (SRE), a sequence that mediates the transient response of many cellular genes to growth stimulation. SRF is required for cardiac differentiation and maturation due to the role in cardiac cell growth and muscle gene regulation. The full-length SRF protein is 67 kDa and  molecular weight of cleaved fragment is 50 kDa and 20 kDa (PMID: 21769134).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag10386 Product name: Recombinant human SRF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-348 aa of BC048211 Sequence: MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPG Predict reactive species\nFull Name: serum response factor (c-fos serum response element-binding transcription factor)\nCalculated Molecular Weight: 508 aa, 52 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC048211\nGene Symbol: SRF\nGene ID (NCBI): 6722\nRRID: AB_2882090\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P11831\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888023294121,"sku":"66742-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66742-1-ig","provider":"Iright","version":"1.0","type":"link"}