{"product_id":"proteintech-66772-1-ig","title":"Proteintech, 66772-1-Ig, SSTR5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SSTR5 (66772-1-Ig) by Proteintech is a Monoclonal antibody targeting SSTR5 in WB, IF-P, ELISA applications with reactivity to Human, Mouse, Rat samples\n66772-1-Ig targets SSTR5 in WB, IF-P, CoIP, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HSC-T6 cells, HeLa cells,  HEK-293 cells,  HepG2 cells,  NIH\/3T3 cells,  Neuro-2a cells\nPositive IF-P detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSomatostatin is a widely distributed peptide with a broad range of biological actions. Two biological forms of somatostatin exist: somatostatin-14 and -28. Somatostatin receptors (SSTR1, 2A and B, 3, 4 and 5) belong to the G protein coupled receptor family and have a wide expression pattern in both normal tissues and solid tumors (PMID: 23872332). SSTR5 has greater affinity for somatostatin-28 than somatostatin-14 (PMID: 8373420).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18615 Product name: Recombinant human SSTR5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-364 aa of BC146576 Sequence: VLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL Predict reactive species\nFull Name: somatostatin receptor 5\nCalculated Molecular Weight: 364 aa, 39 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC146576\nGene Symbol: SSTR5\nGene ID (NCBI): 6755\nRRID: AB_2882118\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P35346\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888017035433,"sku":"66772-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66772-1-ig","provider":"Iright","version":"1.0","type":"link"}