{"product_id":"proteintech-66801-1-ig","title":"Proteintech, 66801-1-Ig, CCR6 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCR6 (66801-1-Ig) by Proteintech is a Monoclonal antibody targeting CCR6 in IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human samples\n66801-1-Ig targets CCR6 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCR6, also known as CD196, is a C-C chemokine receptor that belongs to family A of G protein-coupled receptor superfamily. It is expressed in most B cells, memory T cells, and some subsets of dendritic cells (PMID: 17057190). CCR6 is a receptor for the C-C type chemokine CCL20 (PMID: 9169459). The ligand-receptor pair CCL20-CCR6 is responsible for the chemoattraction of immature dendritic cells, effector\/memory T-cells, and B-cells and plays a role in skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and rheumatoid arthritis (PMID: 12948524). CCR6 polymorphism has been associated with rheumatoid arthritis susceptibility and CCR6 is involved in IL-17-driven autoimmunity in human diseases (PMID: 20453841).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24195 Product name: Recombinant human CCR6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-47 aa of BC037960 Sequence: MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL Predict reactive species\nFull Name: chemokine (C-C motif) receptor 6\nCalculated Molecular Weight: 42 kDa\nGenBank Accession Number: BC037960\nGene Symbol: CCR6\nGene ID (NCBI): 1235\nRRID: AB_2882144\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P51684\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888018837673,"sku":"66801-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66801-1-ig","provider":"Iright","version":"1.0","type":"link"}