{"product_id":"proteintech-66813-1-ig","title":"Proteintech, 66813-1-Ig, DIO2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DIO2 (66813-1-Ig) by Proteintech is a Monoclonal antibody targeting DIO2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n66813-1-Ig targets DIO2 in WB, IHC, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: T-47D cells, LNCaP cells,  MCF-7 cells\nPositive IHC detected in: human thyroid cancer tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nType II iodothyronine deiodinase(DIO2), belongs to the iodothyronine deiodinase family, with two isoform of 30 and 34 kDa. DIO2 can activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3',5-triiodothyronine (T3). DIO2 is thought to be responsible for the 'local' production of T3, and thus important in influencing thyroid hormone action in these tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24057 Product name: Recombinant human DIO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 171-273 aa of BC074882 Sequence: AIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG Predict reactive species\nFull Name: deiodinase, iodothyronine, type II\nCalculated Molecular Weight: 273 aa, 31 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC074882\nGene Symbol: DIO2\nGene ID (NCBI): 1734\nRRID: AB_2882156\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q92813\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888019853481,"sku":"66813-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66813-1-ig","provider":"Iright","version":"1.0","type":"link"}