{"product_id":"proteintech-66817-1-ig","title":"Proteintech, 66817-1-Ig, B7‑H4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe B7‑H4 (66817-1-Ig) by Proteintech is a Monoclonal antibody targeting B7‑H4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n66817-1-Ig targets B7‑H4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells, T-47D cells,  HeLa cells,  A549 cells\nPositive IHC detected in: rat kidney tissue, human cervical cancer tissue,  mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nB7‑H4 also named VTCN1, B7X, or B7S1 is a 282 amino acid protein, which contains 2 immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7‑H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7‑H4 is a single-pass type I membrane protein, which is over-expressed in breast, ovarian, endometrial, renal cell and non-small-cell lung cancers. The predicted molecular weight of B7‑H4 is 31 kDa. The glycosylated B7‑H4 is 50 to 80 kDa, and the non-glycosylated form is 28 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27751 Product name: Recombinant human VTCN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-187 aa of BC065717 Sequence: MFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK Predict reactive species\nFull Name: V-set domain containing T cell activation inhibitor 1\nCalculated Molecular Weight: 282 aa, 31 kDa\nObserved Molecular Weight: 31-35 kDa\nGenBank Accession Number: BC065717\nGene Symbol: B7-H4\nGene ID (NCBI): 79679\nRRID: AB_2882160\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q7Z7D3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888056422569,"sku":"66817-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66817-1-ig","provider":"Iright","version":"1.0","type":"link"}