{"product_id":"proteintech-66822-1-ig","title":"Proteintech, 66822-1-Ig, USP4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP4 (66822-1-Ig) by Proteintech is a Monoclonal antibody targeting USP4 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse samples\n66822-1-Ig targets USP4 in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  HEK-293 cells,  THP-1 cells,  NCI-H1299 cells,  RAW 264.7 cells\nPositive IHC detected in: human breast cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human breast cancer tissue, human liver cancer tissue\nPositive FC (Intra) detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:100-1:300\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP4, also named as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a deubiquitinating enzyme that links to mitogen-activated protein kinase signaling, pre-mRNA splicing, and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28297 Product name: Recombinant human USP4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 567-779 aa of BC125131 Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR Predict reactive species\nFull Name: ubiquitin specific peptidase 4 (proto-oncogene)\nCalculated Molecular Weight: 963 aa, 109 kDa\nObserved Molecular Weight: 109 kDa\nGenBank Accession Number: BC125131\nGene Symbol: USP4\nGene ID (NCBI): 7375\nRRID: AB_2882165\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13107\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887999570089,"sku":"66822-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66822-1-ig","provider":"Iright","version":"1.0","type":"link"}