{"product_id":"proteintech-66839-1-ig","title":"Proteintech, 66839-1-Ig, YY2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe YY2 (66839-1-Ig) by Proteintech is a Monoclonal antibody targeting YY2 in WB, ELISA applications with reactivity to human samples\n66839-1-Ig targets YY2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human kidney tissue, human placenta tissue,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYY2 (Yin-Yang 2) encodes a zinc finger transcription factor similarity to the well-characterized YY1 that locating to nucleus. Both proteins recognize an identical DNA-binding motifs with a high homologous Zinc Finger region, and these transcription factors can act as activators or repressors when bound to DNA (PMID:26350623). It is reported that YY2 is placental mammal-specific and is absent in marsupial and non-mammalian vertebrate species (PMID:16377127). YYs are play an important role in multiple developmental processes , such as implantation, cell differentiation, X inactivation, imprinting and organogenesis (PMID:27191592). YY2 is expressed in kindey, liver, spleen and testicle but not in the colon (PMID:15087442). \nA 41kDa band could be detected.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25373 Product name: Recombinant human YY2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-163 aa of BC137217 Sequence: MASNEDFSITQDLEIPADIVELHDINVEPLPMEDIPTESVQYEDVDGNWIYGGHNHPPLMVLQPLFTNTGYGDHDQEMLMLQTQEEVVGYCDSDNQLGNDLEDQLALPDSIEDEHFQMTLASLSASAASTSTSTQSRSKKPSKKPSGKSATSTEANPAGSSSS Predict reactive species\nFull Name: YY2 transcription factor\nCalculated Molecular Weight: 372 aa, 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC137217\nGene Symbol: YY2\nGene ID (NCBI): 404281\nRRID: AB_2882182\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O15391\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888080638121,"sku":"66839-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66839-1-ig","provider":"Iright","version":"1.0","type":"link"}