{"product_id":"proteintech-66866-1-ig","title":"Proteintech, 66866-1-Ig, CD81 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD81 (66866-1-Ig) by Proteintech is a Monoclonal antibody targeting CD81 in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n66866-1-Ig targets CD81 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, HCT 116 cells,  HEK-293 cells,  Jurkat cells,  LPS treated THP-1 cells,  Ramos cells,  Daudi  cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:600-1:2400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as en essential receptor for HCV (hepatitis C virus) (PMID: 21428934).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig, rabbit, monkey\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27298 Product name: Recombinant human CD81 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 114-199 aa of BC002978 Sequence: VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFS Predict reactive species\nFull Name: CD81 molecule\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC002978\nGene Symbol: CD81\nGene ID (NCBI): 975\nENSEMBL Gene ID: ENSG00000110651\nRRID: AB_2882203\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P60033\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887970209961,"sku":"66866-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66866-1-ig","provider":"Iright","version":"1.0","type":"link"}