{"product_id":"proteintech-66868-1-ig","title":"Proteintech, 66868-1-Ig, CD8a Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD8a (66868-1-Ig) by Proteintech is a Monoclonal antibody targeting CD8a in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n66868-1-Ig targets CD8a in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MOLT-4 cells, human peripheral blood leukocyte\nPositive IHC detected in: human tonsillitis tissue, human appendicitis tissue,  human breast cancer tissue,  human colon cancer tissue,  human lung cancer tissue,  human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:10000-1:40000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 23-183 aa of human CD8a, the alpha chain of CD8 molecule.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11111 Product name: Recombinant human CD8A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 23-183 aa of BC025715 Sequence: QFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI Predict reactive species\nFull Name: CD8a molecule\nCalculated Molecular Weight: 235 aa, 26 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC025715\nGene Symbol: CD8A\nGene ID (NCBI): 925\nENSEMBL Gene ID: ENSG00000153563\nRRID: AB_2882205\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P01732\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887969521833,"sku":"66868-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66868-1-ig","provider":"Iright","version":"1.0","type":"link"}