{"product_id":"proteintech-66928-1-ig","title":"Proteintech, 66928-1-Ig, CFTR Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CFTR (66928-1-Ig) by Proteintech is a Monoclonal antibody targeting CFTR in WB, IHC, ELISA applications with reactivity to human, mouse, rat, rabbit samples\n66928-1-Ig targets CFTR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Calu-3 cells, HEK-293T cells,  HeLa cells,  HT-29 cells,  Caco-2 cells,  MCF-7 cells,  MOLT-4 cells,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue,  A431 cells,  A375 cells,  A549 cells,  NCI-H1299 cells,  HepG2 cells\nPositive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCFTR is a member of the ATP-binding cassette (ABC) family of membrane transport proteins, functioning as a chloride channel responsible for ion flow across epithelial surfaces of lung, sinuses, pancreas, intestine, and liver.  Mutations of CFTR cause cystic fibrosis (CF), a disorder affecting the respiratory, digestive, reproductive systems and sweat glands.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, rabbit\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27810 Product name: Recombinant human CFTR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-80 aa of NM_000492 Sequence: MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWR Predict reactive species\nFull Name: cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7)\nCalculated Molecular Weight: 168 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: NM_000492\nGene Symbol: CFTR\nGene ID (NCBI): 1080\nRRID: AB_2882254\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P13569\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888058814633,"sku":"66928-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66928-1-ig","provider":"Iright","version":"1.0","type":"link"}