{"product_id":"proteintech-66951-1-ig","title":"Proteintech, 66951-1-Ig, DBR1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DBR1 (66951-1-Ig) by Proteintech is a Monoclonal antibody targeting DBR1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to Human, Mouse, Rat, Pig samples\n66951-1-Ig targets DBR1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue, HeLa cells,  MCF-7 cells,  fetal human brain tissue,  pig brain tissue,  rat brain tissue,  mouse brain tissue,  HepG2 cells\nPositive IP detected in: HeLa cells, mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDBR1(Lariat debranching enzyme) hydrolyzes 2-prime-to-5-prime branched phosphodiester bonds at the branch point of excised lariat intron RNA and converts them into linear molecules. DBR1 belongs to the lariat debranching enzyme family. Inhibiton of Dbr1 can suppress TDP-43 toxicity in primary neurons, suggesting that Dbr1 could be a potential therapeutic target for ALS and related TDP-43 proteinopathies (PMID: 23104007). This protein has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8830 Product name: Recombinant human DBR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 204-544 aa of BC009472 Sequence: TLGSPAASELLEHLKPTYWFSAHLHVKFAALMQHQAKDKGQTARATKFLALDKCLPHRDFLQILEIEHDPSAPDYLEYDIEWLTILRATDDLINVTGRLWNMPENNGLHARWDYSATEEGMKEVLEKLNHDLKVPCNFSVTAACYDPSKPQTQMQLIHRINPQTTEFCAQLGIIDINVRLQKSKEEHHVCGEYEEQDDVESNDSGEDQSEYNTDTSALSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDDDDDDAA Predict reactive species\nFull Name: debranching enzyme homolog 1 (S. cerevisiae)\nCalculated Molecular Weight: 544 aa, 62 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC009472\nGene Symbol: DBR1\nGene ID (NCBI): 51163\nRRID: AB_2882274\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UK59\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888060649641,"sku":"66951-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66951-1-ig","provider":"Iright","version":"1.0","type":"link"}