{"product_id":"proteintech-66953-1-ig","title":"Proteintech, 66953-1-Ig, BLNK Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe BLNK (66953-1-Ig) by Proteintech is a Monoclonal antibody targeting BLNK in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, pig, mouse, rat samples\n66953-1-Ig targets BLNK in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, pig, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human spleen tissue, Raji cells,  Daudi cells,  Ramos cells,  pig spleen tissue\nPositive IHC detected in: human appendicitis tissue, mouse thymus tissue,  rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Raji cells, NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:3000-1:8000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBLNK (also known as SLP-65 or BASH) is an important adaptor protein selectively expressed in B-lineage cells. BLNK bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. BLNK has been shown to be necessary for BCR-mediated Ca2+ mobilization, for the activation of mitogen-activated protein kinases such as ERK, JNK, and p38 in a chicken B cell line DT40, and for activation of transcription factors such as NF-AT and NF-κB in human or mouse B cells. BLNK plays a crucial role in pre-BCR-dependent progression of B cell development, BCR-mediated B cell survival, activation, proliferation, and T-independent immune responses.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, pig, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28673 Product name: Recombinant human BLNK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-456 aa of BC018906 Sequence: MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS Predict reactive species\nFull Name: B-cell linker\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC018906\nGene Symbol: BLNK\nGene ID (NCBI): 29760\nRRID: AB_2882276\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8WV28\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888102920361,"sku":"66953-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66953-1-ig","provider":"Iright","version":"1.0","type":"link"}