{"product_id":"proteintech-66991-1-ig","title":"Proteintech, 66991-1-Ig, TRAF5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRAF5 (66991-1-Ig) by Proteintech is a Monoclonal antibody targeting TRAF5 in WB, ELISA applications with reactivity to human samples\n66991-1-Ig targets TRAF5 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-3 cells,  LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRAF5 (also known as TNF receptor-associated factor 5, Ring finger protein 84, RNF8, MGC:39780) is a member of the tumor necrosis factor receptor-associated (TRAF) family of proteins that are characterized by the presence of a meprin and TRAF homology (MATH) domain, a RING-type zinc finger domain, and two TRAF-type zinc finger domains (https:\/\/www.uniprot.org\/uniprot\/O00463). TRAF5 is a scaffold protein that associates with and mediates signal transduction by cell surface receptors belonging to the tumor necrosis factor (TNF) superfamily, including CD27, CD30, CD40, and lymphotoxin-β receptor, positively regulating activation of the canonical NF-κB pathway and c-Jun NH2-terminal kinase (JNK) activation by these receptors (PMIDs: 8999898, 9582383, 8790348, 8663299). \nThe RING-type zinc finger domain of TRAF5 exhibits ubiquitin protein ligase activity and is responsible for Lys-63-linked polyubiquitination of protein targets (PMIDs:23758787, 29176576). This domain has been demonstrated to be required for TRAF5-mediated activation of NF-κB (PMID:8663299).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26070 Product name: Recombinant human TRAF5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-60 aa of BC029600 Sequence: MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGC Predict reactive species\nFull Name: TNF receptor-associated factor 5\nCalculated Molecular Weight: 557 aa, 64 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC029600\nGene Symbol: TRAF5\nGene ID (NCBI): 7188\nRRID: AB_2882308\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O00463\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888332624041,"sku":"66991-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66991-1-ig","provider":"Iright","version":"1.0","type":"link"}