{"product_id":"proteintech-67009-1-ig","title":"Proteintech, 67009-1-Ig, KIF5A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIF5A (67009-1-Ig) by Proteintech is a Monoclonal antibody targeting KIF5A in WB, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat, pig samples\n67009-1-Ig targets KIF5A in WB, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, pig brain tissue,  rat cerebellum tissue,  mouse brain tissue\nPositive IF\/ICC detected in: PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKinesin superfamily proteins (KIFs) are microtubule-based molecular motors essential for the intracellular transport of various cargos, including organelles, proteins, and RNAs. KIF5A is expressed exclusively in neurons and transports neuronal cargoes into axons and dendrites. KIF5A mutations have been associated with Charcot-Marie-Tooth Type 2, an axonal peripheral neuropathy characterized by progressive loss of peripheral sensation and muscle wasting.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15682 Product name: Recombinant human KIF5A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 931-1032 aa of BC146670 Sequence: SPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS Predict reactive species\nFull Name: kinesin family member 5A\nCalculated Molecular Weight: 1032 aa, 117 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC146670\nGene Symbol: KIF5A\nGene ID (NCBI): 3798\nRRID: AB_2882326\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q12840\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888288780457,"sku":"67009-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67009-1-ig","provider":"Iright","version":"1.0","type":"link"}