{"product_id":"proteintech-67041-1-ig","title":"Proteintech, 67041-1-Ig, DNASE1L3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNASE1L3 (67041-1-Ig) by Proteintech is a Monoclonal antibody targeting DNASE1L3 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n67041-1-Ig targets DNASE1L3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, U2OS cells,  Daudi cells,  A431 cells,  LnCaP cells,  Jurkat cells,  K-562 cells,  HepG2 cells,  Raji cells\nPositive IHC detected in: mouse liver tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDeoxyribonuclease 1-like 3 (DNASE1L3, DNase gamma, DNase Y, LS-DNase) is member of a DNASE1 protein family that is identified by similar biochemical properties such as Ca2+\/Mg2+- dependency and an optimal pH of about 7.0 as well as by a high similarity in their nucleic acid and amino acid sequences (PMID:157967140). It is an endonuclease and cleaves double-stranded DNA (and single-stranded DNA) producing 3′-OH\/5′-P ends, which is Ca2+\/Mg2+-dependent and inhibited by Zn2+, but not by monomeric actin (PMID:9665719). In addition, it translocates from the endoplasmic reticulum to the nucleus during apoptosis (PMID: 23229555). DNASE1L3 can be located either in the cytoplasm or in the nucleus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28187 Product name: Recombinant human DNASE1L3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-305 aa of BC015831 Sequence: MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS Predict reactive species\nFull Name: deoxyribonuclease I-like 3\nCalculated Molecular Weight: 305 aa, 36 kDa\nObserved Molecular Weight: 33-38 kDa\nGenBank Accession Number: BC015831\nGene Symbol: DNASE1L3\nGene ID (NCBI): 1776\nRRID: AB_2882355\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13609\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888026800297,"sku":"67041-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67041-1-ig","provider":"Iright","version":"1.0","type":"link"}