{"product_id":"proteintech-67055-1-ig","title":"Proteintech, 67055-1-Ig, ERCC5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERCC5 (67055-1-Ig) by Proteintech is a Monoclonal antibody targeting ERCC5 in WB, ELISA applications with reactivity to human samples\n67055-1-Ig targets ERCC5 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, COLO 320 cells,  Daudi cells,  Ramos cells,  HeLa cells,  HepG2 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human genes correcting DNA repair defects are termed excision-repair cross-complementing or ERCC genes. The ERCC5 gene corrects the excision repair deficiency of Chinese hamster ovary cell line UV135 of complementation group 5. The human ERCC5 gene product is a structure-specific endonuclease required for making the 3-prime incision during DNA nucleotide excision-repair (NER). It also plays an important role in regulating DNA excision repair, removal of bulky lesions caused by environmental chemicals or UV light [PMID:22815677]. The calculated molecular weight of ERCC5 is 133 kDa, but the modified ERCC5 protein is about 200 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28561 Product name: Recombinant human ERCC5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 880-1186 aa of BC031522 Sequence: EFPGHGLEPLLKFSEWWHEAQKNPKIRPNPHDTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT Predict reactive species\nFull Name: excision repair cross-complementing rodent repair deficiency, complementation group 5\nCalculated Molecular Weight: 1186 aa, 133 kDa\nObserved Molecular Weight: 200 kDa\nGenBank Accession Number: BC031522\nGene Symbol: ERCC5\nGene ID (NCBI): 2073\nRRID: AB_2882366\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P28715\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888061829289,"sku":"67055-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67055-1-ig","provider":"Iright","version":"1.0","type":"link"}