{"product_id":"proteintech-67081-1-ig","title":"Proteintech, 67081-1-Ig, FRZB Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FRZB (67081-1-Ig) by Proteintech is a Monoclonal antibody targeting FRZB in WB, ELISA applications with reactivity to Human, mouse samples\n67081-1-Ig targets FRZB in WB, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, 4T1 cells,  MKN-45 cells,  SGC-7901 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFrzb (also known as sFRP3) is a member of the secreted frizzled related protein (SFRP) family, originally identified as a chondrogenic factor during bone morphogenesis (PMID: 29209231). It was subsequently shown to be a regulator in Wnt signaling, and also have a role in regulating cell growth and differentiation in specific cell types. FRZB was seen to be acting as an oncogene in some cancer, such as metastatic renal cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28147 Product name: Recombinant human FRZB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 153-325 aa of BC027855 Sequence: IVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN Predict reactive species\nFull Name: frizzled-related protein\nCalculated Molecular Weight: 325 aa, 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC027855\nGene Symbol: FRZB\nGene ID (NCBI): 2487\nRRID: AB_2882389\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q92765\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888042070185,"sku":"67081-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67081-1-ig","provider":"Iright","version":"1.0","type":"link"}