{"product_id":"proteintech-67083-1-ig","title":"Proteintech, 67083-1-Ig, EAAT2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EAAT2 (67083-1-Ig) by Proteintech is a Monoclonal antibody targeting EAAT2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n67083-1-Ig targets EAAT2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, rat cerebellum tissue,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEAAT2 (also known as GLT-1), is encoded by SLC1A2 and is a glutamate transporter which can clear the majority of extracellular glutamate in brain and prevent brain seizures.Three isoforms of EAAT2 exist due to the alternative splicing. In addition to the 65-70 kDa monomer form, 130-150 kDa dimer of EAAT2 can also be observed on SDS-PAGE.(PMID: 22114258)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19816 Product name: Recombinant human SLC1A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 460-574 aa of BC132768 Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK Predict reactive species\nFull Name: solute carrier family 1 (glial high affinity glutamate transporter), member 2\nCalculated Molecular Weight: 574 aa, 62 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC132768\nGene Symbol: EAAT2\nGene ID (NCBI): 6506\nRRID: AB_2882391\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P43004\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888040988841,"sku":"67083-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67083-1-ig","provider":"Iright","version":"1.0","type":"link"}