{"product_id":"proteintech-67096-1-ig","title":"Proteintech, 67096-1-Ig, ATG9A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATG9A (67096-1-Ig) by Proteintech is a Monoclonal antibody targeting ATG9A in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human samples\n67096-1-Ig targets ATG9A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  Jurkat cells\nPositive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATG9A is the only transmembrane ATG protein essential for autophagy. It plays a key role in the organization of the preautophagosomal structure\/phagophore assembly site (PAS). It has been reported that ATG9A expression is increased in oral squamous cell carcinoma and breast cancers. The inhibition of ATG9A can lead to an inhibition of cancer cell proliferation and invasion.(PMID: 29437695, 29568063)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24278 Product name: Recombinant human ATG9A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 427-528 aa of BC065534 Sequence: DQHMVFCPEQLLRVILAHIHYMPDHWQGVHFGRVAEPHCHTPHPHLLPAPTGPGDYRLLPKLHRGGRWCGRYLLLCSDGCSPAWSSPVAICWADRGLSVPAS Predict reactive species\nFull Name: ATG9 autophagy related 9 homolog A (S. cerevisiae)\nCalculated Molecular Weight: 837 aa, 94 kDa\nObserved Molecular Weight: 94 kDa\nGenBank Accession Number: BC065534\nGene Symbol: ATG9A\nGene ID (NCBI): 79065\nRRID: AB_2882401\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q7Z3C6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888014151849,"sku":"67096-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67096-1-ig","provider":"Iright","version":"1.0","type":"link"}