{"product_id":"proteintech-67121-1-ig","title":"Proteintech, 67121-1-Ig, PI3 Kinase p110 Beta Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PI3 Kinase p110 Beta (67121-1-Ig) by Proteintech is a Monoclonal antibody targeting PI3 Kinase p110 Beta in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, rat samples\n67121-1-Ig targets PI3 Kinase p110 Beta in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  MCF-7 cells,  SH-SY5Y cells,  PC-12 cells\nPositive IHC detected in: human lung cancer tissue, human colon cancer tissue,  human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPIK3CB(phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform) is also named as PIK3C1, PI3K-beta, p110beta. The gene encodes a 1070 amino acid protein which belongs to the PI3\/PI4-kinase family. Phosphoinositide 3-kinases (PI3Ks) have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. The class I PI3 kinases are heterodimers composed of 110 kDa catalytic subunits that associate with regulatory adaptor proteins. Four class I catalytic subunits have been identified, PIK3CA (p110α), PIK3CB (p110β), PIK3CD (p110δ) and PIK3CG (p110γ)(PMID:19177002).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17505 Product name: Recombinant human PIK3CB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 139-373 aa of BC114432 Sequence: SLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTIVSSEV Predict reactive species\nFull Name: phosphoinositide-3-kinase, catalytic, beta polypeptide\nCalculated Molecular Weight: 1070 aa, 123 kDa\nObserved Molecular Weight: 120-130 kDa\nGenBank Accession Number: BC114432\nGene Symbol: PI3 Kinase p110 Beta\nGene ID (NCBI): 5291\nRRID: AB_2882424\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P42338\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887987478697,"sku":"67121-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67121-1-ig","provider":"Iright","version":"1.0","type":"link"}