{"product_id":"proteintech-67126-1-ig","title":"Proteintech, 67126-1-Ig, DDR2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDR2 (67126-1-Ig) by Proteintech is a Monoclonal antibody targeting DDR2 in WB, ELISA applications with reactivity to Human samples\n67126-1-Ig targets DDR2 in WB, IF, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HEK-293 cells,  HepG2 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDR2 (Discoidin domain receptor 2) belongs to the receptor tyrosine kinase (RTK) family and is activated by collagen-binding.DDR2 is implicated in several physiological and pathological processes, including wound healing, angiogenesis, ovulation, spermatogenesis, extracellular matrix (ECM) remodeling and fibrosis, and tumor progression (PMID: 25805889). Moreover, DDR2 is prominently present in the fibroblasts, smooth muscle cells, myofibroblasts, and chondrocytes (PMID: 37834343).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28340 Product name: Recombinant human DDR2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 291-398 aa of NM_001014796 Sequence: MFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNT Predict reactive species\nFull Name: discoidin domain receptor tyrosine kinase 2\nCalculated Molecular Weight: 97 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: NM_001014796\nGene Symbol: DDR2\nGene ID (NCBI): 4921\nRRID: AB_2882426\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q16832\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888039973033,"sku":"67126-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67126-1-ig","provider":"Iright","version":"1.0","type":"link"}