{"product_id":"proteintech-67141-1-ig","title":"Proteintech, 67141-1-Ig, PYK2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PYK2 (67141-1-Ig) by Proteintech is a Monoclonal antibody targeting PYK2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples\n67141-1-Ig targets PYK2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse brain tissue,  K-562 cells,  Ramos cells,  pig brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProline-rich tyrosine kinase 2 (Pyk2; also known as CAK, RAFTK and CADTK) is a cytoplasmic tyrosine kinase implicated to play a role in several intracellular signaling pathways. It is expressed in many cells and tissues and migrated as a 130 kDa band in Western Blotting analysis. The size of PYK2 is 115 kDa, and it expressed in many cells and tissues and migrated as a 130 kDa band, but several lower molecular weight bands (75 kDa, 80 kDa, and 97 kDa) were seen in Western Blotting analysis, possibly due to proteolytic degradation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11487 Product name: Recombinant human PTK2B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 646-1009 aa of BC042599 Sequence: KPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE Predict reactive species\nFull Name: PTK2B protein tyrosine kinase 2 beta\nCalculated Molecular Weight: 1009 aa, 116 kDa\nObserved Molecular Weight: 112-115 kDa\nGenBank Accession Number: BC042599\nGene Symbol: PTK2B\nGene ID (NCBI): 2185\nRRID: AB_2882440\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q14289\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888072577193,"sku":"67141-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67141-1-ig","provider":"Iright","version":"1.0","type":"link"}