{"product_id":"proteintech-67151-1-ig","title":"Proteintech, 67151-1-Ig, HDAC3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HDAC3 (67151-1-Ig) by Proteintech is a Monoclonal antibody targeting HDAC3 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n67151-1-Ig targets HDAC3 in WB, IP, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HSC-T6 cells,  HEK-293 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistone acetylation\/deacetylation alters chromosome structure and affects transcription factor access to DNA. Histone deacetylase (HDAC) and histone acetyltransferase (HAT) are enzymes that regulate transcription by selectively deacetylating or acetylating the (-amino groups of lysines located near the amino termini of core histone proteins. At least 4 classes of HDAC were identified. HDAC3 is a class I HDAC. HDAC3 has histone deacetylase activity and may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. HDAC3 can also down-regulate p53 function and thus modulate cell growth and apoptosis. The gene encoding HDAC3 is regarded as a potential tumor suppressor gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28464 Product name: Recombinant human HDAC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 187-395 aa of BC000614 Sequence: VMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADA Predict reactive species\nFull Name: histone deacetylase 3\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC000614\nGene Symbol: HDAC3\nGene ID (NCBI): 8841\nRRID: AB_2923631\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O15379\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888028897449,"sku":"67151-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67151-1-ig","provider":"Iright","version":"1.0","type":"link"}