{"product_id":"proteintech-67172-1-ig","title":"Proteintech, 67172-1-Ig, FBXO32 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXO32 (67172-1-Ig) by Proteintech is a Monoclonal antibody targeting FBXO32 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n67172-1-Ig targets FBXO32 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, human heart tissue,  pig heart tissue,  pig skeletal muscle tissue,  Rabbit skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissue, rat skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:15000-1:50000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBXO32 (F box only protein 32), also known as Atrogin 1 or MAFbx, is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif F-box. This protein is an E3 ubiquitin ligase that is markedly up-regulated in muscle atrophy. FBXO32 is thus a potential drug target for the treatment of muscle atrophy. Some data support that FBXO32 may play an important role in tumorigenesis. Recent study reveal that FBXO32 targets the oncogenic protein c-Myc for ubiquitination and degradation through the proteasome pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat, pig, canine\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25247 Product name: Recombinant human FBXO32 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-216 aa of BC024030 Sequence: IAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF Predict reactive species\nFull Name: F-box protein 32\nCalculated Molecular Weight: 355 aa, 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC024030\nGene Symbol: FBXO32\nGene ID (NCBI): 114907\nRRID: AB_2882468\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q969P5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887979810985,"sku":"67172-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67172-1-ig","provider":"Iright","version":"1.0","type":"link"}